PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00031140_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 117aa    MW: 13432.9 Da    PI: 4.1957
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00031140_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR125.93.2e-0880117138
                              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCske 38 
                                       +fY  Y+   GFs+rk+k  ks+ ++++++r++vCs++
  FANhyb_icon00031140_a.1.g00001.1  80 RFYLLYSVAKGFSIRKHKLDKSRGSHQVIRRELVCSRQ 117
                                       59**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-680117IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MEESGMGSDM NDLDETTNLL QIESEHEDED SNMVSVDEEE ESESPEGDEL VTDFNGKLYK  60
DLLVCDLANV MFESVVHLNR FYLLYSVAKG FSIRKHKLDK SRGSHQVIRR ELVCSRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294380.21e-17PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
RefseqXP_011461031.11e-17PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
RefseqXP_011461032.11e-17PREDICTED: protein FAR1-RELATED SEQUENCE 9-like